PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g005380.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 358aa    MW: 38026 Da    PI: 5.9629
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g005380.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB155.59.3e-4953146295
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         reqd+f+Pianv+rim+++lP++akis+ +k+t+qecvsefisf t ea+d+cq e+rkt++++d+lwa++++Gf+dy+epl++yl++yre
  Solyc05g005380.1.1  53 REQDQFMPIANVVRIMRRILPSHAKISDGSKQTIQECVSEFISFTTLEANDRCQSEQRKTVTPEDILWAMSKVGFDDYIEPLTLYLNQYRE 143
                         89***************************************************************************************** PP

               NF-YB  93 leg 95 
                         ++g
  Solyc05g005380.1.1 144 FDG 146
                         987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.9E-4449152IPR009072Histone-fold
SuperFamilySSF471132.26E-3455152IPR009072Histone-fold
PfamPF008084.3E-2258122IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.6E-1386104No hitNo description
PRINTSPR006153.6E-13105123No hitNo description
PRINTSPR006153.6E-13124142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MTNGNHVGSG NGGFHSYRRS PQPTPARSPS SDMERSMGMP AHLNQAITEC ITREQDQFMP  60
IANVVRIMRR ILPSHAKISD GSKQTIQECV SEFISFTTLE ANDRCQSEQR KTVTPEDILW  120
AMSKVGFDDY IEPLTLYLNQ YREFDGGESE SLRGETLLVK QQMAHDHGYF VSPPPMDNND  180
MQGDASNGST SQCAVASVDS DIESPAEEGY SRSNAAATLP SPLLGYSRSN AAATLPSPLS  240
GYSRSNAAAT LPSPLSGYSR SNAAATLPSP LSGYSRSNAA ATLPSPLSGY SRSNAAATLP  300
SPLSGYSRSN AAATLPSPLL GYSRSNAAAT LPSPLLGYSR SNAAATPPSP TTWECER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B5e-3553143494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-3553143494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2040820.0Solanum lycopersicum cv. Heinz 1706, chromosome 5 BAC clone C05SLe0086I08, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010320573.11e-159PREDICTED: nuclear transcription factor Y subunit B-6-like
TrEMBLK4BW690.0K4BW69_SOLLC; Uncharacterized protein
STRINGSolyc05g005380.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.18e-59nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]